GRF (1-29) · GHRH (1-29)
| Classification | Synthetic 29-amino-acid growth hormone-releasing hormone fragment |
|---|---|
| Amino acid sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 |
| Short notation | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.9 g/mol |
| CAS number | 86168-78-7 |
| Solubility | Soluble in water and bacteriostatic water. |
| Reported half-life | Short — reported in minutes, reflecting rapid dipeptidyl peptidase cleavage. |
International orders have a 3-vial minimum per product. Case pricing shown is international; US warehouse case pricing may differ and is shown at checkout.
The first 29 residues of human growth hormone-releasing hormone — the shortest fragment retaining full biological activity of the 44-residue native hormone. Unmodified, which is what distinguishes it from analogs like Mod GRF 1-29.
The following describes contexts in which this compound appears in published laboratory literature. Nothing here is a claim of efficacy, safety, or suitability for any use in humans or animals.
| Lyophilized powder | Store lyophilized powder at -20 °C, sealed and protected from light. |
|---|---|
| After reconstitution | Store at 2–8 °C and use within approximately 2–4 weeks. Contains oxidation-prone residues — minimize headspace and avoid repeated freeze-thaw cycles. |
| Shipping | Ships at ambient temperature. |
Open reconstitution calculator →
| Vial | 1 vial (US) | 3 vials (Intl) | Case of 5 | Case of 10 | Stock |
|---|---|---|---|---|---|
| 5mg | $48 | $120 | $140 | $270 | 1 in Denver |
$20 flat USA shipping · solutioning available at $10/vial · Denver stock ships within 1 business day of order confirmation.